SCOPe 2.04: Domain d2peza_: 2pez A:

Lineage for d2peza_ (2pez A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
   automatically mapped to Pfam PF01583

6. Protein automated matches [226942] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225272] (2 PDB entries)

8. Domain d2peza_: 2pez A: [205517]
   automated match to d1m7gd_
   complexed with dat, ggz; mutant

Details for d2peza_

PDB Entry: 2pez, 1.4 Å

PDB Description: Crystal structrue of deletion mutant of APS-kinase domain of human PAPS-synthetase 1 in complex with cyclic PAPS and dADP

PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPS synthetase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1)

SCOPe Domain Sequences for d2peza_:

Sequence; same for both SEQRES and ATOM records:

>d2peza_ c.37.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgctvwltglsgagkttvsmaleeylvchgipcytldgdnirqglnknlgfspedreenv
rriaevaklfadaglvcitsfispytqdrnnarqihegaslpffevfvdaplhvceqrdv
kglykkarageikgftgidseyekpeapelvlktdscdvndcvqqvvellqerdiv

Timeline for d2peza_:

• d2peza_ first appeared in SCOPe 2.03
  
• d2peza_ appears in SCOPe 2.05
  
• d2peza_ appears in the current release, SCOPe 2.08