Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (107 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries) |
Domain d2pera1: 2per A:11-97 [205513] Other proteins in same PDB: d2pera2 automated match to d1k0ma2 complexed with mnb |
PDB Entry: 2per (more details), 2 Å
SCOPe Domain Sequences for d2pera1:
Sequence, based on SEQRES records: (download)
>d2pera1 c.47.1.0 (A:11-97) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpeielfvkagsdgesigncpfcqrlfmilwlkgvkfnvttvdmtrkpeelkdlapgtnp pflvynkelktdfikieefleqtlapp
>d2pera1 c.47.1.0 (A:11-97) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpeielfvkagsdgesigncpfcqrlfmilwlkgvkfnvttvdmnppflvynkelktdfi kieefleqtlapp
Timeline for d2pera1: