SCOPe 2.03: Domain d2pera1: 2per A:11-97

Lineage for d2pera1 (2per A:11-97)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries)

8. Domain d2pera1: 2per A:11-97 [205513]
   Other proteins in same PDB: d2pera2
   automated match to d1k0ma2
   complexed with mnb

Details for d2pera1

PDB Entry: 2per, 2 Å

PDB Description: crystal structure of human chloride intracellular channel protein 2

PDB Compounds: (A:) Chloride intracellular channel protein 2

SCOPe Domain Sequences for d2pera1:

Sequence, based on SEQRES records:

>d2pera1 c.47.1.0 (A:11-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpeielfvkagsdgesigncpfcqrlfmilwlkgvkfnvttvdmtrkpeelkdlapgtnp
pflvynkelktdfikieefleqtlapp

Sequence, based on observed residues (ATOM records):

>d2pera1 c.47.1.0 (A:11-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpeielfvkagsdgesigncpfcqrlfmilwlkgvkfnvttvdmnppflvynkelktdfi
kieefleqtlapp

Timeline for d2pera1:

• d2pera1 is new in SCOPe 2.03-stable
  
• d2pera1 appears in SCOPe 2.04
  
• d2pera1 appears in the current release, SCOPe 2.08