Lineage for d1qacb_ (1qac B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353797Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88521] (10 PDB entries)
  8. 2353811Domain d1qacb_: 1qac B: [20550]
    VL dimer of Bence-Jones protein LEN

Details for d1qacb_

PDB Entry: 1qac (more details), 1.8 Å

PDB Description: change in dimerization mode by removal of a single unsatisfied polar residue
PDB Compounds: (B:) immunoglobulin light chain variable domain

SCOPe Domain Sequences for d1qacb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qacb_ b.1.1.1 (B:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnsknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyyclqyystpysfgqgtkleikr

SCOPe Domain Coordinates for d1qacb_:

Click to download the PDB-style file with coordinates for d1qacb_.
(The format of our PDB-style files is described here.)

Timeline for d1qacb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qaca_