Lineage for d2on7c1 (2on7 C:1-77)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487938Species Necator americanus [TaxId:51031] [224893] (6 PDB entries)
  8. 2487950Domain d2on7c1: 2on7 C:1-77 [205328]
    Other proteins in same PDB: d2on7a2, d2on7b2, d2on7c2, d2on7d2
    automated match to d1tw9a2

Details for d2on7c1

PDB Entry: 2on7 (more details), 2.4 Å

PDB Description: Structure of NaGST-1
PDB Compounds: (C:) Na Glutathione S-transferase 1

SCOPe Domain Sequences for d2on7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2on7c1 c.47.1.0 (C:1-77) automated matches {Necator americanus [TaxId: 51031]}
mvhykltyfairgagecarqifaladqefedvrldkeqfakvkpdlpfgqvpvlevdgkq
laqslaicrylarqfgf

SCOPe Domain Coordinates for d2on7c1:

Click to download the PDB-style file with coordinates for d2on7c1.
(The format of our PDB-style files is described here.)

Timeline for d2on7c1: