Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Necator americanus [TaxId:51031] [224849] (6 PDB entries) |
Domain d2on5g2: 2on5 G:78-206 [205321] Other proteins in same PDB: d2on5a1, d2on5b1, d2on5c1, d2on5d1, d2on5e1, d2on5f1, d2on5g1, d2on5h1 automated match to d1tw9a1 complexed with edo, gsh |
PDB Entry: 2on5 (more details), 1.9 Å
SCOPe Domain Sequences for d2on5g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2on5g2 a.45.1.0 (G:78-206) automated matches {Necator americanus [TaxId: 51031]} agktpfeealvdsvadqykdyineirpylrvvagvdqgdpeklfkelllparekffgfmk kfleksksgylvgdsvtyadlclaehtsgiaakfpsiydgfpeikahaekvrsipalkkw ietrpetkf
Timeline for d2on5g2: