Lineage for d2oljb1 (2olj B:0-240)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480013Species Geobacillus stearothermophilus [TaxId:1422] [188756] (8 PDB entries)
  8. 2480015Domain d2oljb1: 2olj B:0-240 [205287]
    Other proteins in same PDB: d2olja2, d2oljb2
    automated match to d1b0ua_
    complexed with adp, gol, mg

Details for d2oljb1

PDB Entry: 2olj (more details), 2.05 Å

PDB Description: abc protein artp in complex with adp/mg2+
PDB Compounds: (B:) Amino acid ABC transporter

SCOPe Domain Sequences for d2oljb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oljb1 c.37.1.0 (B:0-240) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
qmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegeii
idginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakame
lldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsvm
kqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflskv
f

SCOPe Domain Coordinates for d2oljb1:

Click to download the PDB-style file with coordinates for d2oljb1.
(The format of our PDB-style files is described here.)

Timeline for d2oljb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oljb2