Lineage for d2jl4a2 (2jl4 A:80-212)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327334Species Ralstonia sp. [TaxId:70356] [225493] (2 PDB entries)
  8. 2327337Domain d2jl4a2: 2jl4 A:80-212 [205106]
    Other proteins in same PDB: d2jl4a1, d2jl4b1
    automated match to d1e6ba1
    complexed with gsh

Details for d2jl4a2

PDB Entry: 2jl4 (more details), 2.3 Å

PDB Description: holo structure of maleyl pyruvate isomerase, a bacterial glutathione-s-transferase in zeta class
PDB Compounds: (A:) maleylpyruvate isomerase

SCOPe Domain Sequences for d2jl4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jl4a2 a.45.1.0 (A:80-212) automated matches {Ralstonia sp. [TaxId: 70356]}
allpadadgrqrvralaaivgcdihpinnrrileylrktfgadeaainawcgtwisagfd
ayeallavdpkrgrysfgdtptladcylvpqvesarrfqvdltpypliravdaacgelda
frraapaaqpdsa

SCOPe Domain Coordinates for d2jl4a2:

Click to download the PDB-style file with coordinates for d2jl4a2.
(The format of our PDB-style files is described here.)

Timeline for d2jl4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jl4a1