SCOPe 2.03: Domain d2jkjf_: 2jkj F:

Lineage for d2jkjf_ (2jkj F:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
   Pfam PF04619

6. Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)

7. Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
   Uniprot Q57254 P24093 23-159

8. Domain d2jkjf_: 2jkj F: [205080]
   automated match to d1usqf_
   complexed with clm, so4, th8

Details for d2jkjf_

PDB Entry: 2jkj, 2.3 Å

PDB Description: drae adhesin in complex with chloramphenicol succinate

PDB Compounds: (F:) dr hemagglutinin structural subunit

SCOPe Domain Sequences for d2jkjf_:

Sequence; same for both SEQRES and ATOM records:

>d2jkjf_ b.2.3.6 (F:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
qtntppgnytltltggywak

Timeline for d2jkjf_:

• d2jkjf_ is new in SCOPe 2.03-stable
  
• d2jkjf_ appears in SCOPe 2.04
  
• d2jkjf_ appears in the current release, SCOPe 2.08, called d2jkjf1