SCOPe 2.03: Domain d2jhxb_: 2jhx B:

Lineage for d2jhxb_ (2jhx B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein automated matches [190534] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187499] (8 PDB entries)

8. Domain d2jhxb_: 2jhx B: [205046]
   automated match to d2jhya_
   mutant

Details for d2jhxb_

PDB Entry: 2jhx, 1.6 Å

PDB Description: crystal structure of rhogdi e155h, e157h mutant

PDB Compounds: (B:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2jhxb_:

Sequence; same for both SEQRES and ATOM records:

>d2jhxb_ b.1.18.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraehyhfltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

Timeline for d2jhxb_:

• d2jhxb_ is new in SCOPe 2.03-stable
  
• d2jhxb_ appears in SCOPe 2.04
  
• d2jhxb_ appears in the current release, SCOPe 2.08