SCOPe 2.03: Domain d2jcga2: 2jcg A:60-332

Lineage for d2jcga2 (2jcg A:60-332)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)

6. Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species)

7. Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries)
   Uniprot P46828 58-322 ! Uniprot P46828

8. Domain d2jcga2: 2jcg A:60-332 [205016]
   Other proteins in same PDB: d2jcga1
   automated match to d1zvva2
   complexed with ca

Details for d2jcga2

PDB Entry: 2jcg, 2.6 Å

PDB Description: apo form of the catabolite control protein a (ccpa) from bacillus megaterium, with the dna binding domain

PDB Compounds: (A:) Glucose-resistance amylase regulator

SCOPe Domain Sequences for d2jcga2:

Sequence; same for both SEQRES and ATOM records:

>d2jcga2 c.93.1.1 (A:60-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
tttvgviipdisnifyaelargiediasmykyniilsnsdqnqdkqlhllnnmlgkqvdg
iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
vamrlltkymnketvdssivelphriefrqstk

Timeline for d2jcga2:

• d2jcga2 is new in SCOPe 2.03-stable
  
• d2jcga2 appears in SCOPe 2.04
  
• d2jcga2 appears in the current release, SCOPe 2.08