Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) |
Family d.151.1.0: automated matches [191468] (1 protein) not a true family |
Protein automated matches [190734] (7 species) not a true protein |
Species Neisseria meningitidis [TaxId:487] [187907] (2 PDB entries) |
Domain d2jc5a_: 2jc5 A: [205013] automated match to d2v0ra_ complexed with bcn, dio, gol, mg |
PDB Entry: 2jc5 (more details), 1.5 Å
SCOPe Domain Sequences for d2jc5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jc5a_ d.151.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 487]} mlkiisanvngirsaykkgfyeyiaasgadivcvqelkaqeadlsadmknphgmhghwhc aekrgysgvavyskrkpdnvqigmgieefdregrfvrcdfgrlsvislylpsgssaeerq qvkyrfldafypmleamknegrdivvcgdwniahqnidlknwkgnqknsgflpeerewig kvihklgwtdmwrtlypdvpgytwwsnrgqayakdvgwridyqmvtpelaakavsahvyk dekfsdhaplvveydyaae
Timeline for d2jc5a_: