SCOPe 2.03: Domain d2jc5a_: 2jc5 A:

Lineage for d2jc5a_ (2jc5 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.0: automated matches [191468] (1 protein)
   not a true family

6. Protein automated matches [190734] (7 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:487] [187907] (2 PDB entries)

8. Domain d2jc5a_: 2jc5 A: [205013]
   automated match to d2v0ra_
   complexed with bcn, dio, gol, mg

Details for d2jc5a_

PDB Entry: 2jc5, 1.5 Å

PDB Description: apurinic apyrimidinic (ap) endonuclease (nape) from neisseria meningitidis

PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d2jc5a_:

Sequence; same for both SEQRES and ATOM records:

>d2jc5a_ d.151.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 487]}
mlkiisanvngirsaykkgfyeyiaasgadivcvqelkaqeadlsadmknphgmhghwhc
aekrgysgvavyskrkpdnvqigmgieefdregrfvrcdfgrlsvislylpsgssaeerq
qvkyrfldafypmleamknegrdivvcgdwniahqnidlknwkgnqknsgflpeerewig
kvihklgwtdmwrtlypdvpgytwwsnrgqayakdvgwridyqmvtpelaakavsahvyk
dekfsdhaplvveydyaae

Timeline for d2jc5a_:

• d2jc5a_ is new in SCOPe 2.03-stable
  
• d2jc5a_ appears in SCOPe 2.04
  
• d2jc5a_ appears in the current release, SCOPe 2.08