SCOPe 2.03: Domain d2izob1: 2izo B:1-127

Lineage for d2izob1 (2izo B:1-127)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (7 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [225132] (4 PDB entries)

8. Domain d2izob1: 2izo B:1-127 [204912]
   automated match to d1ud9a1
   protein/DNA complex; complexed with mg, zn

Details for d2izob1

PDB Entry: 2izo, 2.9 Å

PDB Description: structure of an archaeal pcna1-pcna2-fen1 complex

PDB Compounds: (B:) DNA polymerase sliding clamp c

SCOPe Domain Sequences for d2izob1:

Sequence; same for both SEQRES and ATOM records:

>d2izob1 d.131.1.0 (B:1-127) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mmkakvidavsfsyilrtvgdflseanfivtkegirvsgidpsrvvfldiflpssyfegf
evsqekeiigfkledvndilkrvlkddtlilssneskltltfdgeftrsfelpliqvest
sppsvnl

Timeline for d2izob1:

• d2izob1 is new in SCOPe 2.03-stable
  
• d2izob1 appears in SCOPe 2.04
  
• d2izob1 appears in the current release, SCOPe 2.08