SCOPe 2.04: Domain d2iwoa_: 2iwo A:

Lineage for d2iwoa_ (2iwo A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (75 PDB entries)

8. Domain d2iwoa_: 2iwo A: [204875]
   automated match to d1n7ea_

Details for d2iwoa_

PDB Entry: 2iwo, 1.7 Å

PDB Description: 12th pdz domain of multiple pdz domain protein mpdz (casp target)

PDB Compounds: (A:) Multiple PDZ domain protein

SCOPe Domain Sequences for d2iwoa_:

Sequence, based on SEQRES records:

>d2iwoa_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrtvemkkgptdslgisiaggvgsplgdvpifiammhptgvaaqtqklrvgdrivticgt
stegmthtqavnllknasgsiemqvvaggdvsetsv

Sequence, based on observed residues (ATOM records):

>d2iwoa_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrtvemkkslgisiaggvgsplgdvpifiammhptgvaaqtqklrvgdrivticgtsteg
mthtqavnllknasgsiemqvvaggdvsetsv

Timeline for d2iwoa_:

• d2iwoa_ first appeared in SCOPe 2.03
  
• d2iwoa_ appears in SCOPe 2.05
  
• d2iwoa_ appears in the current release, SCOPe 2.08