SCOPe 2.07: Domain d2iwfa2: 2iwf A:467-597

Lineage for d2iwfa2 (2iwf A:467-597)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (29 species)
   not a true protein

7. Species Achromobacter cycloclastes [TaxId:223] [225121] (13 PDB entries)

8. Domain d2iwfa2: 2iwf A:467-597 [204868]
   Other proteins in same PDB: d2iwfa1, d2iwfb1
   automated match to d1fwxa1
   complexed with ca, cl, cu, cuz, na

Details for d2iwfa2

PDB Entry: 2iwf, 1.86 Å

PDB Description: resting form of pink nitrous oxide reductase from achromobacter cycloclastes

PDB Compounds: (A:) nitrous-oxide reductase

SCOPe Domain Sequences for d2iwfa2:

Sequence; same for both SEQRES and ATOM records:

>d2iwfa2 b.6.1.0 (A:467-597) automated matches {Achromobacter cycloclastes [TaxId: 223]}
svwdrndplwaetrkqaeadevdidewteavirdgnkvrvymtsvapsfsqpsftvkegd
evtvivtnldeiddlthgftmgnhgvamevgpqqtssvtfvaanpgvywyycqwfchalh
memrgrmfvep

Timeline for d2iwfa2:

• d2iwfa2 first appeared in SCOPe 2.03
  
• d2iwfa2 appears in SCOPe 2.06
  
• d2iwfa2 appears in the current release, SCOPe 2.08