SCOPe 2.07: Domain d2iova_: 2iov A:

Lineage for d2iova_ (2iov A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (25 species)
   not a true protein

7. Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)

8. Domain d2iova_: 2iov A: [204835]
   Other proteins in same PDB: d2iovc2, d2iovd2
   automated match to d2pxwb_

Details for d2iova_

PDB Entry: 2iov, 1.8 Å

PDB Description: bright-state structure of the reversibly switchable fluorescent protein dronpa

PDB Compounds: (A:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d2iova_:

Sequence; same for both SEQRES and ATOM records:

>d2iova_ d.22.1.0 (A:) automated matches {Echinophyllia sp. [TaxId: 301887]}
msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahsel

Timeline for d2iova_:

• d2iova_ first appeared in SCOPe 2.03
  
• d2iova_ appears in SCOPe 2.06
  
• d2iova_ appears in the current release, SCOPe 2.08