SCOPe 2.03: Domain d2ijxa1: 2ijx A:1-126

Lineage for d2ijxa1 (2ijx A:1-126)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (7 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [225354] (3 PDB entries)

8. Domain d2ijxa1: 2ijx A:1-126 [204796]
   automated match to d1ud9a1
   complexed with edo

Details for d2ijxa1

PDB Entry: 2ijx, 1.9 Å

PDB Description: Crystal structure of PCNA3 monomer from Sulfolobus solfataricus.

PDB Compounds: (A:) DNA polymerase sliding clamp A

SCOPe Domain Sequences for d2ijxa1:

Sequence; same for both SEQRES and ATOM records:

>d2ijxa1 d.131.1.0 (A:1-126) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
mkvvyddvrvlkdiiqalarlvdeavlkfkqdsvelvaldrahislisvnlpremfkeyd
vndefkfgfntqylmkilkvakrkeaieiasespdsviiniigstnrefnvrnlevseqe
ipeinl

Timeline for d2ijxa1:

• d2ijxa1 is new in SCOPe 2.03-stable
  
• d2ijxa1 appears in SCOPe 2.04
  
• d2ijxa1 appears in the current release, SCOPe 2.08