Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel protein [56901] (3 species) |
Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries) |
Domain d2ih1c_: 2ih1 C: [204781] Other proteins in same PDB: d2ih1a1, d2ih1a2, d2ih1a3, d2ih1b1, d2ih1b2 automated match to d1s5hc_ complexed with 1em, k |
PDB Entry: 2ih1 (more details), 2.4 Å
SCOPe Domain Sequences for d2ih1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ih1c_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvaygdl ypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerr
Timeline for d2ih1c_: