SCOPe 2.07: Domain d2hnya2: 2hny A:430-537

Lineage for d2hnya2 (2hny A:430-537)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries)

8. Domain d2hnya2: 2hny A:430-537 [204630]
   Other proteins in same PDB: d2hnya1, d2hnyb_
   automated match to d1vrta1
   complexed with mg, nvp, po4; mutant

Details for d2hnya2

PDB Entry: 2hny, 2.5 Å

PDB Description: crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with nevirapine

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2hnya2:

Sequence, based on SEQRES records:

>d2hnya2 c.55.3.0 (A:430-537) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvp

Sequence, based on observed residues (ATOM records):

>d2hnya2 c.55.3.0 (A:430-537) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
yalgiiqaqpdqseselvnqiieqlikkekvylawvp

Timeline for d2hnya2:

• d2hnya2 first appeared in SCOPe 2.03
  
• d2hnya2 appears in SCOPe 2.06
  
• d2hnya2 appears in the current release, SCOPe 2.08