SCOPe 2.04: Domain d2hczx1: 2hcz X:4-145

Lineage for d2hczx1 (2hcz X:4-145)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families)

5. Family b.52.1.0: automated matches [227180] (1 protein)
   not a true family

6. Protein automated matches [226899] (2 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [225118] (1 PDB entry)

8. Domain d2hczx1: 2hcz X:4-145 [204538]
   Other proteins in same PDB: d2hczx2
   automated match to d1n10a2
   complexed with fca, man

Details for d2hczx1

PDB Entry: 2hcz, 2.75 Å

PDB Description: crystal structure of expb1 (zea m 1), a beta-expansin and group-1 pollen allergen from maize

PDB Compounds: (X:) Beta-expansin 1a

SCOPe Domain Sequences for d2hczx1:

Sequence; same for both SEQRES and ATOM records:

>d2hczx1 b.52.1.0 (X:4-145) automated matches {Maize (Zea mays) [TaxId: 4577]}
kvppgpnittnyngkwltaratwygqpngagapdnggacgiknvnlppysgmtacgnvpi
fkdgkgcgscyevrckekpecsgnpvtvyitdmnyepiapyhfdlsgkafgslakpglnd
kirhcgimdvefrrvrckypag

Timeline for d2hczx1:

• d2hczx1 first appeared in SCOPe 2.03
  
• d2hczx1 appears in SCOPe 2.05
  
• d2hczx1 appears in the current release, SCOPe 2.08