SCOPe 2.07: Domain d2h84a2: 2h84 A:2999-3147

Lineage for d2h84a2 (2h84 A:2999-3147)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Dictyostelium discoideum [TaxId:352472] [225117] (1 PDB entry)

8. Domain d2h84a2: 2h84 A:2999-3147 [204527]
   automated match to d1bi5a2
   complexed with p6g

Details for d2h84a2

PDB Entry: 2h84, 2.9 Å

PDB Description: crystal structure of the c-terminal type iii polyketide synthase (pks iii) domain of 'steely1' (a type i/iii pks hybrid from dictyostelium)

PDB Compounds: (A:) Steely1

SCOPe Domain Sequences for d2h84a2:

Sequence; same for both SEQRES and ATOM records:

>d2h84a2 c.95.1.0 (A:2999-3147) automated matches {Dictyostelium discoideum [TaxId: 352472]}
lyevmcsinrsfpntenamvwdlekegwnlgldasipivigsgieafvdtlldkaklqts
taisakdceflihtggksilmnienslgidpkqtkntwdvyhaygnmssasvifvmdhar
kskslptysislafgpglafegcflknvv

Timeline for d2h84a2:

• d2h84a2 first appeared in SCOPe 2.03
  
• d2h84a2 appears in SCOPe 2.06
  
• d2h84a2 appears in the current release, SCOPe 2.08