Lineage for d2gh5a3 (2gh5 A:364-478)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569462Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2569463Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2569464Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2569504Protein Glutathione reductase [55426] (3 species)
  7. 2569514Species Human (Homo sapiens) [TaxId:9606] [55427] (23 PDB entries)
  8. 2569522Domain d2gh5a3: 2gh5 A:364-478 [204365]
    Other proteins in same PDB: d2gh5a1, d2gh5a2, d2gh5b1, d2gh5b2
    automated match to d3grsa3
    complexed with eli, fad, gol, po4

Details for d2gh5a3

PDB Entry: 2gh5 (more details), 1.7 Å

PDB Description: Crystal Structure of human Glutathione Reductase complexed with a Fluoro-Analogue of the Menadione Derivative M5
PDB Compounds: (A:) glutathione reductase, mitochondrial

SCOPe Domain Sequences for d2gh5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gh5a3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr

SCOPe Domain Coordinates for d2gh5a3:

Click to download the PDB-style file with coordinates for d2gh5a3.
(The format of our PDB-style files is described here.)

Timeline for d2gh5a3: