Lineage for d2gdrc1 (2gdr C:1-80)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487240Species Burkholderia xenovorans [TaxId:266265] [225115] (2 PDB entries)
  8. 2487247Domain d2gdrc1: 2gdr C:1-80 [204341]
    Other proteins in same PDB: d2gdra2, d2gdrb2, d2gdrc2, d2gdrd2, d2gdre2, d2gdrf2
    automated match to d1n2aa2
    complexed with gsh

Details for d2gdrc1

PDB Entry: 2gdr (more details), 2.1 Å

PDB Description: Crystal structure of a bacterial glutathione transferase
PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d2gdrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdrc1 c.47.1.0 (C:1-80) automated matches {Burkholderia xenovorans [TaxId: 266265]}
mklyyspgacslsphialreaglnfelvqvdlaskktasgqdylevnpagyvpclqlddg
rtltegpaivqyvadqvpgk

SCOPe Domain Coordinates for d2gdrc1:

Click to download the PDB-style file with coordinates for d2gdrc1.
(The format of our PDB-style files is described here.)

Timeline for d2gdrc1: