SCOPe 2.08: Domain d2fh8a1: 2fh8 A:170-287

Lineage for d2fh8a1 (2fh8 A:170-287)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Pullulanase PulA [158883] (1 species)
   contains two E-set domains in tandem

7. Species Klebsiella pneumoniae [TaxId:573] [158884] (6 PDB entries)
   Uniprot P07206 170-294! Uniprot P07206 295-409

8. Domain d2fh8a1: 2fh8 A:170-287 [204216]
   Other proteins in same PDB: d2fh8a3, d2fh8a4
   automated match to d2fhfa2
   complexed with ca
   has additional insertions and/or extensions that are not grouped together

Details for d2fh8a1

PDB Entry: 2fh8, 1.9 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with isomaltose

PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fh8a1:

Sequence; same for both SEQRES and ATOM records:

>d2fh8a1 b.1.18.2 (A:170-287) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
aafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvkltpttvn
qqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatqvqtagvlddt

Timeline for d2fh8a1:

• d2fh8a1 first appeared in SCOPe 2.03
  
• d2fh8a1 appears in SCOPe 2.07