Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.91: PEP carboxykinase-like [53794] (1 superfamily) contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side |
Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) |
Family c.91.1.0: automated matches [196141] (1 protein) not a true family |
Protein automated matches [196142] (6 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225084] (4 PDB entries) |
Domain d2fahd2: 2fah D:279-641 [204187] Other proteins in same PDB: d2faha1, d2fahb1, d2fahc1, d2fahd1 automated match to d1khba1 complexed with 20s, gdp, mla, mn |
PDB Entry: 2fah (more details), 2.09 Å
SCOPe Domain Sequences for d2fahd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fahd2 c.91.1.0 (D:279-641) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} wlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiawmkfdd egrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgldeptep gvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifggrrpr gvplvveafgwrhgvfmgsamrseataaaehkggrlmhdpfamrpffgynagrylehwls tglrsnarlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptpigwvp kegdldlgglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaelegleerv rkm
Timeline for d2fahd2: