SCOPe 2.07: Domain d2fahd2: 2fah D:279-641

Lineage for d2fahd2 (2fah D:279-641)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
   contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side

4. Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families)

5. Family c.91.1.0: automated matches [196141] (1 protein)
   not a true family

6. Protein automated matches [196142] (6 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225084] (4 PDB entries)

8. Domain d2fahd2: 2fah D:279-641 [204187]
   Other proteins in same PDB: d2faha1, d2fahb1, d2fahc1, d2fahd1
   automated match to d1khba1
   complexed with 20s, gdp, mla, mn

Details for d2fahd2

PDB Entry: 2fah, 2.09 Å

PDB Description: the structure of mitochondrial pepck, complex with mn and gdp

PDB Compounds: (D:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d2fahd2:

Sequence; same for both SEQRES and ATOM records:

>d2fahd2 c.91.1.0 (D:279-641) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
wlaehmlilgvtspsgekrymaaafpsacgktnlammtpslpgwrihcvgddiawmkfdd
egrlrainpergffgvapgtssrtnpnamatiarntiftnvglrsdggvywdgldeptep
gvtytswlgkpwkhgdpepcahpnsrfcapadqcpimdprwddpegvpidaiifggrrpr
gvplvveafgwrhgvfmgsamrseataaaehkggrlmhdpfamrpffgynagrylehwls
tglrsnarlprlfhvnwflrdnegrfvwpgfghnarvlawifgriqgrdtarptpigwvp
kegdldlgglpgvdysqlfpmekgfweeecrqlreyygenfgadlprdvmaelegleerv
rkm

Timeline for d2fahd2:

• d2fahd2 first appeared in SCOPe 2.03
  
• d2fahd2 appears in SCOPe 2.06
  
• d2fahd2 appears in the current release, SCOPe 2.08