Lineage for d2f57b_ (2f57 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1674829Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1674830Protein automated matches [190417] (19 species)
    not a true protein
  7. 1674960Species Human (Homo sapiens) [TaxId:9606] [187294] (476 PDB entries)
  8. 1675008Domain d2f57b_: 2f57 B: [204175]
    automated match to d2cdza_
    complexed with 23d, trs

Details for d2f57b_

PDB Entry: 2f57 (more details), 1.8 Å

PDB Description: crystal structure of the human p21-activated kinase 5
PDB Compounds: (B:) Serine/threonine-protein kinase PAK 7

SCOPe Domain Sequences for d2f57b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f57b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyfqsmsrvsheqfraalqlvvspgdpreylanfikigegstgivciatekhtgkqvavk
kmdlrkqqrrellfnevvimrdyhhdnvvdmyssylvgdelwvvmefleggaltdivtht
rmneeqiatvclsvlralsylhnqgvihrdiksdsilltsdgriklsdfgfcaqvskevp
krkslvgtpywmapevisrlpygtevdiwslgimviemidgeppyfnepplqamrrirds
lpprvkdlhkvssvlrgfldlmlvrepsqrataqellghpflklagppscivplmrqyrh

SCOPe Domain Coordinates for d2f57b_:

Click to download the PDB-style file with coordinates for d2f57b_.
(The format of our PDB-style files is described here.)

Timeline for d2f57b_: