Lineage for d1f3rb1 (1f3r B:1-123)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 8045Species scFv MAB198, (rat), kappa L chain [48887] (1 PDB entry)
  8. 8046Domain d1f3rb1: 1f3r B:1-123 [20416]

Details for d1f3rb1

PDB Entry: 1f3r (more details)

PDB Description: complex between fv antibody fragment and an analogue of the main immunogenic region of the acetylcholine receptor

SCOP Domain Sequences for d1f3rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3rb1 b.1.1.1 (B:1-123) Immunoglobulin (variable domains of L and H chains) {scFv MAB198, (rat), kappa L chain}
qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn
salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpgtmvt
vss

SCOP Domain Coordinates for d1f3rb1:

Click to download the PDB-style file with coordinates for d1f3rb1.
(The format of our PDB-style files is described here.)

Timeline for d1f3rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f3rb2