Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
Protein automated matches [226871] (15 species) not a true protein |
Species Slime mold (Physarum polycephalum) [TaxId:5791] [225254] (1 PDB entry) |
Domain d2eixb2: 2eix B:151-281 [204130] Other proteins in same PDB: d2eixa1, d2eixb1 automated match to d1qx4a2 complexed with fad, gol, iod, na |
PDB Entry: 2eix (more details), 1.56 Å
SCOPe Domain Sequences for d2eixb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eixb2 c.25.1.0 (B:151-281) automated matches {Slime mold (Physarum polycephalum) [TaxId: 5791]} pnmvkemgmiaggtgitpmlqvaraiiknpkektiinlifanvneddillrtelddmakk ysnfkvyyvlnnppagwtggvgfvsadmikqhfsppssdikvmmcgppmmnkamqghlet lgytpeqwfif
Timeline for d2eixb2: