SCOPe 2.04: Domain d2egob_: 2ego B:

Lineage for d2egob_ (2ego B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (5 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (10 PDB entries)

8. Domain d2egob_: 2ego B: [204121]
   automated match to d2egna_

Details for d2egob_

PDB Entry: 2ego, 1.8 Å

PDB Description: crystal structure of tamalin pdz domain

PDB Compounds: (B:) General receptor for phosphoinositides 1-associated scaffold protein

SCOPe Domain Sequences for d2egob_:

Sequence, based on SEQRES records:

>d2egob_ b.36.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sqqrkvltlekgdnqtfgfeiqtyglhhreeqrvemvtfvarvhesspaqlagltpgdti
asvnglnvegirhreivdiikasgnvlrletlygt

Sequence, based on observed residues (ATOM records):

>d2egob_ b.36.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sqqrkvltlekgdnqtfgfeiqtyglhhvemvtfvarvhesspaqlagltpgdtiasvng
lnvegirhreivdiikasgnvlrletlygt

Timeline for d2egob_:

• d2egob_ first appeared in SCOPe 2.03
  
• d2egob_ appears in SCOPe 2.05
  
• d2egob_ appears in the current release, SCOPe 2.08, called d2egob1