Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [225116] (2 PDB entries) |
Domain d2dsac2: 2dsa C:81-200 [204039] Other proteins in same PDB: d2dsaa1, d2dsab1, d2dsac1, d2dsad1 automated match to d1n2aa1 complexed with gsh, hpx |
PDB Entry: 2dsa (more details), 2.1 Å
SCOPe Domain Sequences for d2dsac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dsac2 a.45.1.0 (C:81-200) automated matches {Burkholderia xenovorans [TaxId: 266265]} qlapangsferyhlqqwlnfisselhksfsplfnpassdewknavrqslntrlgqvarql ehapyllgdqlsvadiylfvvlgwsayvnidlspwpslqafqgrvggreavqsalraegl
Timeline for d2dsac2: