Lineage for d2d5hd1 (2d5h D:6-247)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1558340Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1558910Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 1558911Protein automated matches [190388] (18 species)
    not a true protein
  7. 1558994Species Soybean (Glycine max) [TaxId:3847] [225175] (2 PDB entries)
  8. 1559005Domain d2d5hd1: 2d5h D:6-247 [203932]
    automated match to d1fxza1
    complexed with co3, mg

Details for d2d5hd1

PDB Entry: 2d5h (more details), 2.8 Å

PDB Description: Crystal Structure of Recombinant Soybean Proglycinin A3B4 subunit, its Comparison with Mature Glycinin A3B4 subunit, Responsible for Hexamer Assembly
PDB Compounds: (D:) glycinin A3B4 subunit

SCOPe Domain Sequences for d2d5hd1:

Sequence, based on SEQRES records: (download)

>d2d5hd1 b.82.1.0 (D:6-247) automated matches {Soybean (Glycine max) [TaxId: 3847]}
fnecqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspy
pqmiivvqgkgaigfafpgcpetfekpqqqssrrgsrsqqqlqdshqkirhfnegdvlvi
ppgvpywtyntgdepvvaislldtsnfnnqldqnprvfylagnpdiehpetmqqqqqqks
hggrkqgqhqqqeeeggsvlsgfskhflaqsfntnedtaeklrspdderkqivtveggls
vi

Sequence, based on observed residues (ATOM records): (download)

>d2d5hd1 b.82.1.0 (D:6-247) automated matches {Soybean (Glycine max) [TaxId: 3847]}
fnecqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspy
pqmiivvqgkgaigfafpgcpetfqdshqkirhfnegdvlvippgvpywtyntgdepvva
islldtsnfnnqldqnprvfylagnpdiehpetmqqqqeeeggsvlsgfskhflaqsfnt
nedtaeklrspdderkqivtvegglsvi

SCOPe Domain Coordinates for d2d5hd1:

Click to download the PDB-style file with coordinates for d2d5hd1.
(The format of our PDB-style files is described here.)

Timeline for d2d5hd1: