Lineage for d2d5ha2 (2d5h A:326-493)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1330392Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1330393Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1330950Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 1330951Protein automated matches [190388] (15 species)
    not a true protein
  7. 1331019Species Soybean (Glycine max) [TaxId:3847] [225175] (2 PDB entries)
  8. 1331025Domain d2d5ha2: 2d5h A:326-493 [203927]
    automated match to d1fxza2
    complexed with co3, mg

Details for d2d5ha2

PDB Entry: 2d5h (more details), 2.8 Å

PDB Description: Crystal Structure of Recombinant Soybean Proglycinin A3B4 subunit, its Comparison with Mature Glycinin A3B4 subunit, Responsible for Hexamer Assembly
PDB Compounds: (A:) glycinin A3B4 subunit

SCOPe Domain Sequences for d2d5ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d5ha2 b.82.1.0 (A:326-493) automated matches {Soybean (Glycine max) [TaxId: 3847]}
ictmklheniarpsradfynpkagristlnsltlpalrqfglsaqyvvlyrngiysphwn
lnansviyvtrgkgrvrvvncqgnavfdgelrrgqllvvpqnfvvaeqggeqgleyvvfk
thhnavssyikdvfraipsevlsnsynlgqsqvrqlkyqgnsgplvnp

SCOPe Domain Coordinates for d2d5ha2:

Click to download the PDB-style file with coordinates for d2d5ha2.
(The format of our PDB-style files is described here.)

Timeline for d2d5ha2: