Lineage for d2d3ma2 (2d3m A:249-405)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1627417Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1627418Protein automated matches [196909] (45 species)
    not a true protein
  7. 1627419Species Aloe arborescens [TaxId:45385] [225155] (3 PDB entries)
  8. 1627429Domain d2d3ma2: 2d3m A:249-405 [203896]
    automated match to d1bi5a2
    complexed with coa

Details for d2d3ma2

PDB Entry: 2d3m (more details), 1.6 Å

PDB Description: Pentaketide chromone synthase complexed with coenzyme A
PDB Compounds: (A:) pentaketide chromone synthase

SCOPe Domain Sequences for d2d3ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d3ma2 c.95.1.0 (A:249-405) automated matches {Aloe arborescens [TaxId: 45385]}
mfeivctkqtvipntedvihlhlretgmmfylskgspmtisnnveaclidvfksvgitpp
edwnslfwiphpggraildqveaklklrpekfraartvlwdygnmvsasvgyildemrrk
saakgletygeglewgvllgfgpgitvetillhslpl

SCOPe Domain Coordinates for d2d3ma2:

Click to download the PDB-style file with coordinates for d2d3ma2.
(The format of our PDB-style files is described here.)

Timeline for d2d3ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2d3ma1