Lineage for d2d39b1 (2d39 B:115-326)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2608754Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2608755Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2608856Family d.171.1.0: automated matches [191465] (1 protein)
    not a true family
  6. 2608857Protein automated matches [190726] (1 species)
    not a true protein
  7. 2608858Species Human (Homo sapiens) [TaxId:9606] [187887] (49 PDB entries)
  8. 2608884Domain d2d39b1: 2d39 B:115-326 [203893]
    Other proteins in same PDB: d2d39a2, d2d39b2
    automated match to d2j1gd_
    complexed with ca

Details for d2d39b1

PDB Entry: 2d39 (more details), 1.9 Å

PDB Description: Trivalent Recognition Unit of Innate Immunity System; Crystal Structure of human M-ficolin Fibrinogen-like Domain
PDB Compounds: (B:) ficolin-1

SCOPe Domain Sequences for d2d39b1:

Sequence, based on SEQRES records: (download)

>d2d39b1 d.171.1.0 (B:115-326) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prnckdlldrgyflsgwhtiylpdcrpltvlcdmdtdgggwtvfqrrmdgsvdfyrdwaa
ykqgfgsqlgefwlgndnihaltaqgsselrvdlvdfegnhqfakyksfkvadeaekykl
vlgafvggsagnsltghnnnffstkdqdndvsssncaekfqgawwyadchasnlnglylm
gphesyanginwsaakgykysykvsemkvrpa

Sequence, based on observed residues (ATOM records): (download)

>d2d39b1 d.171.1.0 (B:115-326) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prnckdlldrgyflsgwhtiylpdcrpltvlcdmdtdgggwtvfqrrmdgsvdfyrdwaa
ykqgfgsqlgefwlgndnihaltaqgsselrvdlvdfegnhqfakyksfkvadeaekykl
vlgafvggsagnsltghnnnffstkdqdndvsssncaekfqgawwyadchasnlnglyla
nginwsysykvsemkvrpa

SCOPe Domain Coordinates for d2d39b1:

Click to download the PDB-style file with coordinates for d2d39b1.
(The format of our PDB-style files is described here.)

Timeline for d2d39b1: