Lineage for d1cf8h1 (1cf8 H:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740567Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (40 PDB entries)
    Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor
  8. 2740582Domain d1cf8h1: 1cf8 H:1-113 [20379]
    Other proteins in same PDB: d1cf8h2, d1cf8l1, d1cf8l2
    part of catalytic Fab HA-19A4 with a polyene cyclase activity
    complexed with cd, haz

Details for d1cf8h1

PDB Entry: 1cf8 (more details), 2.7 Å

PDB Description: Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions
PDB Compounds: (H:) protein (catalytic antibody 19a4 (heavy chain))

SCOPe Domain Sequences for d1cf8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf8h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsa

SCOPe Domain Coordinates for d1cf8h1:

Click to download the PDB-style file with coordinates for d1cf8h1.
(The format of our PDB-style files is described here.)

Timeline for d1cf8h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cf8h2