SCOPe 2.03: Domain d2chwa1: 2chw A:144-322

Lineage for d2chwa1 (2chw A:144-322)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
   contains Pfam PF00788 and Pfam PF02196

6. Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
   includes parts of the flanking linkers

7. Species Human (Homo sapiens) [TaxId:9606] [54276] (19 PDB entries)

8. Domain d2chwa1: 2chw A:144-322 [203787]
   Other proteins in same PDB: d2chwa2, d2chwa3, d2chwa4
   automated match to d1e8ya3
   complexed with 039

Details for d2chwa1

PDB Entry: 2chw, 2.6 Å

PDB Description: a pharmacological map of the pi3-k family defines a role for p110 alpha in signaling: the structure of complex of phosphoinositide 3- kinase gamma with inhibitor pik-39

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d2chwa1:

Sequence, based on SEQRES records:

>d2chwa1 d.15.1.5 (A:144-322) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee

Sequence, based on observed residues (ATOM records):

>d2chwa1 d.15.1.5 (A:144-322) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakdfvlrvcgr
deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee

Timeline for d2chwa1:

• d2chwa1 is new in SCOPe 2.03-stable
  
• d2chwa1 appears in SCOPe 2.04
  
• d2chwa1 appears in the current release, SCOPe 2.08