SCOPe 2.07: Domain d2c7yb2: 2c7y B:312-441

Lineage for d2c7yb2 (2c7y B:312-441)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225073] (3 PDB entries)

8. Domain d2c7yb2: 2c7y B:312-441 [203748]
   automated match to d1afwa2

Details for d2c7yb2

PDB Entry: 2c7y, 2.1 Å

PDB Description: plant enzyme

PDB Compounds: (B:) 3-ketoacyl-coa thiolase 2

SCOPe Domain Sequences for d2c7yb2:

Sequence; same for both SEQRES and ATOM records:

>d2c7yb2 c.95.1.0 (B:312-441) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kglpvlgvfrtfaavgvdpaimgigpavaipaavkaaglelddidlfeineafasqfvyc
rnklgldpekinvnggamaighplgatgarcvatllhemkrrgkdcrfgvvsmcigtgmg
aaavfergdg

Timeline for d2c7yb2:

• d2c7yb2 first appeared in SCOPe 2.03
  
• d2c7yb2 appears in SCOPe 2.06
  
• d2c7yb2 appears in the current release, SCOPe 2.08