Lineage for d2c3tc2 (2c3t C:80-240)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327166Species Human (Homo sapiens) [TaxId:9606] [225003] (13 PDB entries)
  8. 2327185Domain d2c3tc2: 2c3t C:80-240 [203737]
    Other proteins in same PDB: d2c3ta1, d2c3tb1, d2c3tc1, d2c3td1
    automated match to d2ljra1
    mutant

Details for d2c3tc2

PDB Entry: 2c3t (more details), 2.4 Å

PDB Description: human glutathione-s-transferase t1-1, w234r mutant, apo form
PDB Compounds: (C:) glutathione s-transferase theta 1

SCOPe Domain Sequences for d2c3tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3tc2 a.45.1.0 (C:80-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpdywypqdlqararvdeylawqhttlrrsclralwhkvmfpvflgepvspqtlaatlae
ldvtlqlledkflqnkafltgphisladlvaitelmhpvgagcqvfegrpklatwrqrve
aavgedlfqeahevilkakdfppadptikqklmprvlamir

SCOPe Domain Coordinates for d2c3tc2:

Click to download the PDB-style file with coordinates for d2c3tc2.
(The format of our PDB-style files is described here.)

Timeline for d2c3tc2: