SCOPe 2.03: Domain d2btua2: 2btu A:168-341

Lineage for d2btua2 (2btu A:168-341)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (6 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225123] (1 PDB entry)

8. Domain d2btua2: 2btu A:168-341 [203635]
   Other proteins in same PDB: d2btua1, d2btub1
   automated match to d1clia2

Details for d2btua2

PDB Entry: 2btu, 2.31 Å

PDB Description: crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution.

PDB Compounds: (A:) phosphoribosyl-aminoimidazole synthetase

SCOPe Domain Sequences for d2btua2:

Sequence, based on SEQRES records:

>d2btua2 d.139.1.0 (A:168-341) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
tgekieaghvliglassgihsngyslvrkvlledgelsldriygrlelplgeellkptki
yvkpilellknhevygmahitgggfieniprmlpegigaeielgswkiqpifsllqevgk
leekemfnifnmgigmvvavkeedakdivrlleeqgetariigrtvqgagvtfn

Sequence, based on observed residues (ATOM records):

>d2btua2 d.139.1.0 (A:168-341) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
tgekieaghvliglassgihsngyslvrkvlledgeliygrlelplgeellkptkiyvkp
ilellknhevygmahitgggfieniprmlpegigaeielgswkiqpifsllqevgkleek
emfnifnmgigmvvavkeedakdivrlleeqgetariigrtvqgagvtfn

Timeline for d2btua2:

• d2btua2 is new in SCOPe 2.03-stable
  
• d2btua2 appears in SCOPe 2.04
  
• d2btua2 appears in the current release, SCOPe 2.08