SCOPe 2.04: Domain d2b5oa1: 2b5o A:111-242

Lineage for d2b5oa1 (2b5o A:111-242)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (16 species)
   not a true protein

7. Species Synechococcus sp. [TaxId:32049] [225027] (1 PDB entry)

8. Domain d2b5oa1: 2b5o A:111-242 [203557]
   Other proteins in same PDB: d2b5oa2, d2b5ob2
   automated match to d1frna1
   complexed with fad, so4

Details for d2b5oa1

PDB Entry: 2b5o, 2.5 Å

PDB Description: ferredoxin-nadp reductase

PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d2b5oa1:

Sequence; same for both SEQRES and ATOM records:

>d2b5oa1 b.43.4.0 (A:111-242) automated matches {Synechococcus sp. [TaxId: 32049]}
svpvniyrpktpflgkcienyelvdeggsgtvrhvtfdisegdlrylegqsigiippged
kngkphklrlysiastrhgdmednktvslcvrqleyqdpesgetvygvcstylcnlpvgt
ddvkitgpvgke

Timeline for d2b5oa1:

• d2b5oa1 first appeared in SCOPe 2.03
  
• d2b5oa1 appears in SCOPe 2.05
  
• d2b5oa1 appears in the current release, SCOPe 2.08