Lineage for d2b1ib2 (2b1i B:201-593)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1393213Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 1393214Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 1393378Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (1 protein)
    duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs
  6. 1393379Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species)
  7. 1393380Species Chicken (Gallus gallus) [TaxId:9031] [64200] (8 PDB entries)
    Uniprot P31335
  8. 1393388Domain d2b1ib2: 2b1i B:201-593 [203538]
    Other proteins in same PDB: d2b1ia1, d2b1ib1
    automated match to d1g8ma2
    complexed with 93a, k

Details for d2b1ib2

PDB Entry: 2b1i (more details), 2.02 Å

PDB Description: crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
PDB Compounds: (B:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d2b1ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b1ib2 c.97.1.4 (B:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]}
gvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcdalnawqlvkelkqalgi
paaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasayarsrgadrmssfgdfi
alsdicdvptakiisrevsdgvvapgyeeealkilskkknggycvlqmdpnyepddneir
tlyglqlmqkrnnavidrslfknivtknktlpesavrdlivasiavkytqsnsvcyakdg
qvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagvkraevsnaidqyvtgti
gededlvkwqamfeevpaqlteaekkqwiakltavslssdaffpfrdnvdrakrigvqfi
vapsgsaadevvieacnelgitlihtnlrlfhh

SCOPe Domain Coordinates for d2b1ib2:

Click to download the PDB-style file with coordinates for d2b1ib2.
(The format of our PDB-style files is described here.)

Timeline for d2b1ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b1ib1