Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (1 protein) duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs |
Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [64200] (8 PDB entries) Uniprot P31335 |
Domain d2b1ib2: 2b1i B:201-593 [203538] Other proteins in same PDB: d2b1ia1, d2b1ib1 automated match to d1g8ma2 complexed with 93a, k |
PDB Entry: 2b1i (more details), 2.02 Å
SCOPe Domain Sequences for d2b1ib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1ib2 c.97.1.4 (B:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} gvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcdalnawqlvkelkqalgi paaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasayarsrgadrmssfgdfi alsdicdvptakiisrevsdgvvapgyeeealkilskkknggycvlqmdpnyepddneir tlyglqlmqkrnnavidrslfknivtknktlpesavrdlivasiavkytqsnsvcyakdg qvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagvkraevsnaidqyvtgti gededlvkwqamfeevpaqlteaekkqwiakltavslssdaffpfrdnvdrakrigvqfi vapsgsaadevvieacnelgitlihtnlrlfhh
Timeline for d2b1ib2: