Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (8 species) not a true protein |
Species Achromobacter cycloclastes [TaxId:223] [225121] (3 PDB entries) |
Domain d2avfb1: 2avf B:11-159 [203488] automated match to d1bq5a1 complexed with cl, cu |
PDB Entry: 2avf (more details), 2.6 Å
SCOPe Domain Sequences for d2avfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avfb1 b.6.1.0 (B:11-159) automated matches {Achromobacter cycloclastes [TaxId: 223]} tlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngsvpg plmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkatkpg vfvyhcapegmvpwhvtsgmngaimvlpr
Timeline for d2avfb1: