Lineage for d2a9cb1 (2a9c B:108-343)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2610526Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif
  4. 2610527Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (2 families) (S)
  5. 2610528Family d.176.1.1: Oxidoreductase molybdopterin-binding domain [56525] (2 proteins)
    Pfam PF00174
  6. 2610546Protein Sulfite oxidase, middle catalytic domain [56526] (2 species)
  7. 2610547Species Chicken (Gallus gallus) [TaxId:9031] [56527] (6 PDB entries)
  8. 2610556Domain d2a9cb1: 2a9c B:108-343 [203412]
    Other proteins in same PDB: d2a9ca2, d2a9cb2
    automated match to d1ogpa2
    complexed with gol, mo, mte, so4; mutant

Details for d2a9cb1

PDB Entry: 2a9c (more details), 2.5 Å

PDB Description: crystal structure of r138q mutant of recombinant chicken sulfite oxidase with the bound product, sulfate, at the active site
PDB Compounds: (B:) sulfite oxidase

SCOPe Domain Sequences for d2a9cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9cb1 d.176.1.1 (B:108-343) Sulfite oxidase, middle catalytic domain {Chicken (Gallus gallus) [TaxId: 9031]}
rvnsqkpfnaeppaellaerfltpnelfftqnhlpvpavepssyrlrvdgpgggtlslsl
aelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistarwggarlrdvllhag
fpeelqgewhvcfegldadpggapygasipygralspaadvllayemngtelprdhgfpv
rvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdtvdyrtapaiq

SCOPe Domain Coordinates for d2a9cb1:

Click to download the PDB-style file with coordinates for d2a9cb1.
(The format of our PDB-style files is described here.)

Timeline for d2a9cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a9cb2