Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Engineered (including hybrid species) [88533] (52 PDB entries) SQ NA # humanized antidoby; bactericidal Fab-h6831 SQ NA # Humanized antibody SQ NA # humanized antibody SQ NA # engineered antibody SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody |
Domain d1b2wl1: 1b2w L:1-107 [20306] Other proteins in same PDB: d1b2wh1, d1b2wh2, d1b2wl2 part of a humanized anti-gamma-interferon Fab |
PDB Entry: 1b2w (more details), 2.9 Å
SCOP Domain Sequences for d1b2wl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b2wl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} diqmtqspstlsasvgdrvtitckasenvdtyvswyqqkpgkapklliygasnrytgvps rfsgsgsgtdftltisslqpddfatyycgqsynypftfgqgtkvevk
Timeline for d1b2wl1: