Lineage for d1b2wl1 (1b2w L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740697Species Engineered (including hybrid species) [88533] (60 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2740767Domain d1b2wl1: 1b2w L:1-107 [20306]
    Other proteins in same PDB: d1b2wh1, d1b2wh2, d1b2wl2
    part of a humanized anti-gamma-interferon Fab

Details for d1b2wl1

PDB Entry: 1b2w (more details), 2.9 Å

PDB Description: comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody
PDB Compounds: (L:) protein (antibody (light chain))

SCOPe Domain Sequences for d1b2wl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2wl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspstlsasvgdrvtitckasenvdtyvswyqqkpgkapklliygasnrytgvps
rfsgsgsgtdftltisslqpddfatyycgqsynypftfgqgtkvevk

SCOPe Domain Coordinates for d1b2wl1:

Click to download the PDB-style file with coordinates for d1b2wl1.
(The format of our PDB-style files is described here.)

Timeline for d1b2wl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b2wl2