SCOP 1.57: Domain d1a5fl1: 1a5f L:1-113

Lineage for d1a5fl1 (1a5f L:1-113)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Anti-E-selectin Fab (mouse), kappa L chain [48864] (1 PDB entry)

8. Domain d1a5fl1: 1a5f L:1-113 [20302]
   Other proteins in same PDB: d1a5fh2, d1a5fl2

Details for d1a5fl1

PDB Entry: 1a5f, 2.8 Å

PDB Description: fab fragment of a monoclonal anti-e-selectin antibody

SCOP Domain Sequences for d1a5fl1:

Sequence; same for both SEQRES and ATOM records:

>d1a5fl1 b.1.1.1 (L:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-E-selectin Fab (mouse), kappa L chain}
divmtqspssltvttgekvtmtckssqsllnsgaqknyltwyqqkpgqspklliywastr
esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelk

Timeline for d1a5fl1:

• d1a5fl1 first appeared (with stable ids) in SCOP 1.55
  
• d1a5fl1 appears in SCOP 1.59
  
• d1a5fl1 appears in the current release, SCOPe 2.08