Lineage for d1wpqb2 (1wpq B:194-349)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334748Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2334836Domain d1wpqb2: 1wpq B:194-349 [203016]
    Other proteins in same PDB: d1wpqa1, d1wpqb1
    automated match to d1evya1
    complexed with 13p, nad, so4

Details for d1wpqb2

PDB Entry: 1wpq (more details), 2.5 Å

PDB Description: Ternary Complex Of Glycerol 3-phosphate Dehydrogenase 1 with NAD and dihydroxyactone
PDB Compounds: (B:) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic

SCOPe Domain Sequences for d1wpqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpqb2 a.100.1.0 (B:194-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpvssatfl
escgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetarelysilqhk
glvdkfplfmavykvcyegqpvgefihclqnhpehm

SCOPe Domain Coordinates for d1wpqb2:

Click to download the PDB-style file with coordinates for d1wpqb2.
(The format of our PDB-style files is described here.)

Timeline for d1wpqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wpqb1