Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries) |
Domain d1wpqb2: 1wpq B:194-349 [203016] Other proteins in same PDB: d1wpqa1, d1wpqb1 automated match to d1evya1 complexed with 13p, nad, so4 |
PDB Entry: 1wpq (more details), 2.5 Å
SCOPe Domain Sequences for d1wpqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpqb2 a.100.1.0 (B:194-349) automated matches {Human (Homo sapiens) [TaxId: 9606]} vdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpvssatfl escgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetarelysilqhk glvdkfplfmavykvcyegqpvgefihclqnhpehm
Timeline for d1wpqb2: