Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (133 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225005] (4 PDB entries) |
Domain d1vf2b1: 1vf2 B:1004-1080 [202946] Other proteins in same PDB: d1vf2a2, d1vf2b2 automated match to d1f3ba2 complexed with gtx, zn |
PDB Entry: 1vf2 (more details), 2.15 Å
SCOPe Domain Sequences for d1vf2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf2b1 c.47.1.0 (B:1004-1080) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} kpvlyyfngrgkmesirwllaaagvefeevfletreqyekllqsgilmfqqvpmveidgm klvqtrailnyiagkyn
Timeline for d1vf2b1: