Lineage for d1vf2b1 (1vf2 B:1004-1080)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602634Species Chicken (Gallus gallus) [TaxId:9031] [225005] (4 PDB entries)
  8. 1602637Domain d1vf2b1: 1vf2 B:1004-1080 [202946]
    Other proteins in same PDB: d1vf2a2, d1vf2b2
    automated match to d1f3ba2
    complexed with gtx, zn

Details for d1vf2b1

PDB Entry: 1vf2 (more details), 2.15 Å

PDB Description: cgsta1-1 in complex with s-hexyl-glutathione
PDB Compounds: (B:) Glutathione S-transferase 3

SCOPe Domain Sequences for d1vf2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf2b1 c.47.1.0 (B:1004-1080) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kpvlyyfngrgkmesirwllaaagvefeevfletreqyekllqsgilmfqqvpmveidgm
klvqtrailnyiagkyn

SCOPe Domain Coordinates for d1vf2b1:

Click to download the PDB-style file with coordinates for d1vf2b1.
(The format of our PDB-style files is described here.)

Timeline for d1vf2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vf2b2