Lineage for d1tjta1 (1tjt A:42-155)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325181Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2325182Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2325260Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2325261Protein automated matches [226856] (4 species)
    not a true protein
  7. 2325267Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)
  8. 2325324Domain d1tjta1: 1tjt A:42-155 [202921]
    automated match to d1sh5a1

Details for d1tjta1

PDB Entry: 1tjt (more details), 2.19 Å

PDB Description: x-ray structure of the human alpha-actinin isoform 3 at 2.2a resolution
PDB Compounds: (A:) Alpha-actinin 3

SCOPe Domain Sequences for d1tjta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjta1 a.40.1.0 (A:42-155) automated matches {Human (Homo sapiens) [TaxId: 9606]}
awekqqrktftawcnshlrkagtqienieedfrnglklmlllevisgerlprpdkgkmrf
hkianvnkaldfiaskgvklvsigaeeivdgnlkmtlgmiwtiilrfaiqdisv

SCOPe Domain Coordinates for d1tjta1:

Click to download the PDB-style file with coordinates for d1tjta1.
(The format of our PDB-style files is described here.)

Timeline for d1tjta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tjta2