SCOPe 2.07: Domain d4k50m_: 4k50 M:

Lineage for d4k50m_ (4k50 M:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein Viral RNA polymerase [56695] (17 species)

7. Species Human rhinovirus 16 [TaxId:31708] [188024] (2 PDB entries)

8. Domain d4k50m_: 4k50 M: [202834]
   Other proteins in same PDB: d4k50i_
   automated match to d1tp7a_
   protein/RNA complex; complexed with act, gol, so4

Details for d4k50m_

PDB Entry: 4k50, 2.93 Å

PDB Description: Rhinovirus 16 polymerase elongation complex (r1_form)

PDB Compounds: (M:) RNA polymerase 3D-POL

SCOPe Domain Sequences for d4k50m_:

Sequence; same for both SEQRES and ATOM records:

>d4k50m_ e.8.1.4 (M:) Viral RNA polymerase {Human rhinovirus 16 [TaxId: 31708]}
gqiqiskhvkdvglpsihtptktklqpsvfydifpgskepavltekdprlkvdfdsalfs
kykgntecslnehiqvavahysaqlatldidpqpiamedsvfgmdglealdlntsagypy
vtlgikkkdlinnktkdisklklaldkydvdlpmitflkdelrkkdkiaagktrvieass
indtilfrtvygnlfskfhlnpgvvtgcavgcdpetfwskiplmldgdcimafdytnydg
sihpiwfkalgmvldnlsfnptlinrlcnskhifkstyyeveggvpsgcsgtsifnsmin
niiirtlvldaykhidldklkiiaygddvifsykykldmeaiakegqkygltitpadkss
efkeldygnvtflkrgfrqddkykflihptfpveeiyesirwtkkpsqmqehvlslchlm
whngpeiykdfetkirsvsagralyippyellrhewyekf

Timeline for d4k50m_:

• d4k50m_ first appeared in SCOPe 2.03
  
• d4k50m_ appears in SCOPe 2.06
  
• d4k50m_ appears in the current release, SCOPe 2.08