Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein Viral RNA polymerase [56695] (16 species) |
Species Human rhinovirus 16 [TaxId:31708] [188024] (2 PDB entries) |
Domain d4k50e_: 4k50 E: [202833] Other proteins in same PDB: d4k50i_ automated match to d1tp7a_ protein/RNA complex; complexed with act, gol, so4 |
PDB Entry: 4k50 (more details), 2.93 Å
SCOPe Domain Sequences for d4k50e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k50e_ e.8.1.4 (E:) Viral RNA polymerase {Human rhinovirus 16 [TaxId: 31708]} gqiqiskhvkdvglpsihtptktklqpsvfydifpgskepavltekdprlkvdfdsalfs kykgntecslnehiqvavahysaqlatldidpqpiamedsvfgmdglealdlntsagypy vtlgikkkdlinnktkdisklklaldkydvdlpmitflkdelrkkdkiaagktrvieass indtilfrtvygnlfskfhlnpgvvtgcavgcdpetfwskiplmldgdcimafdytnydg sihpiwfkalgmvldnlsfnptlinrlcnskhifkstyyeveggvpsgcsgtsifnsmin niiirtlvldaykhidldklkiiaygddvifsykykldmeaiakegqkygltitpadkss efkeldygnvtflkrgfrqddkykflihptfpveeiyesirwtkkpsqmqehvlslchlm whngpeiykdfetkirsvsagralyippyellrhewyekf
Timeline for d4k50e_: